robustness raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2025-10-18. Anything still debated is marked as such rather than presented as settled.
Detection in HPLC testing commonly relies on ultraviolet-visible absorbance, fluorescence, refractive index, or mass spectrometry. A diode array detector records full spectra across a wavelength range, which helps identify co-eluting peaks. Mass spectrometry provides mass-to-charge ratios and can confirm molecular identity at low concentrations. The choice of detector depends on analyte structure, required sensitivity, and whether quantitation or identification is the goal. No single detector works for every compound, and method development often compares responses before selecting one.
High-performance liquid chromatography is an analytical technique that separates components of a liquid sample by passing it through a packed column under pressure. A pump delivers a mobile phase at a controlled flow rate, and an injector introduces the sample into the stream. Differences in interaction with the stationary phase cause analytes to migrate at different rates. Detectors record elution as peaks, and a data system converts signals into a chromatogram. The method is suited to compounds that dissolve in a liquid and are not volatile enough for gas chromatography.
Reversed-phase chromatography dominates modern HPLC testing, using a nonpolar stationary phase such as chemically bonded octadecyl groups and a polar mobile phase of water mixed with organic solvent. Analytes partition between the mobile and stationary phases according to hydrophobicity. Gradient elution changes the mobile phase composition over time to separate compounds with a wide range of retention. Isocratic elution keeps the composition constant and is simpler for routine assays. Column temperature, pH, and flow rate influence selectivity, peak shape, and retention time, so these parameters are controlled during a validated method.
Separation performance depends on particle size, pore size, column length, and the chemistry of the stationary phase. Smaller particles generally improve efficiency but require higher pressure and suitable instrumentation. The mobile phase often contains buffers and organic solvents that influence retention and selectivity. Testing labs select conditions based on the analytes, sample matrix, and required sensitivity. Method development frequently involves screening several columns and solvent mixtures before a final set of conditions is chosen.
High-performance liquid chromatography is an analytical technique that separates components in a liquid sample by passing them through a packed column under pressure. A pump delivers a mobile phase at a controlled flow rate, and an injector introduces the sample into the stream. Differences in how analytes partition between the mobile phase and the stationary phase cause them to exit the column at different times. Detection then records a signal proportional to the amount of each separated substance. The resulting chromatogram provides retention times and peak areas for identification and quantification.
| Property | Value | Notes |
|---|---|---|
| Separation mode | Reversed-phase | Most common for neutral and moderately polar analytes |
| Column particle size | 3–5 µm | Smaller particles improve resolution but raise backpressure |
| Mobile phase pH range | 2–8 | Silica-based columns may degrade outside this range |
| Typical flow rate | 1.0–2.0 mL/min | For analytical columns with 4.6 mm internal diameter |
| Common synonyms | HPLC, LC, high-pressure liquid chromatography | High-performance liquid chromatography is the standard expansion |
System suitability testing is performed before and during analytical runs to confirm that the instrument and method are working as expected. Common checks include retention time, peak area, resolution between critical pairs, tailing factor, and theoretical plate count. Results are compared with predefined limits, and a failed check requires investigation before sample results are reported. Quality control samples at low, middle, and high concentrations are injected at intervals to monitor accuracy and precision. Blank injections detect carryover and contamination, while control charts track performance over time.
Data handling and documentation are central to HPLC quality control. Electronic systems should have audit trails that record changes to methods, sequences, and results. Integration parameters, such as peak baseline and threshold, can affect reported areas and must be defined in advance. Out-of-specification results trigger a structured investigation that may include reanalysis, instrument checks, and review of sample preparation. Regulatory inspections often examine raw data, audit trails, and training records to verify that reported results are traceable and reliable.
Method validation establishes that an HPLC procedure is suitable for its intended use. Key parameters include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantitation, and robustness. Accuracy measures agreement with a true or accepted value, while precision describes repeatability and intermediate precision. Specificity confirms that the method measures the analyte without interference from impurities, degradants, or excipients. Validation is documented in a protocol and report, and acceptance criteria are set before experiments begin. Regulatory guidance varies by region, but the general principles are widely harmonized.
Method validation demonstrates that an HPLC procedure is suitable for its intended purpose. Common validation parameters include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantification, and robustness. Accuracy reflects agreement with a reference value, while precision describes repeatability under defined conditions. Specificity shows whether the method can measure the analyte in the presence of impurities or matrix components. Validation documents are reviewed before a method is used for routine testing or regulatory submissions.
System suitability testing is performed before and during analytical runs to confirm that the instrument and method are working as expected. Typical checks include retention time, peak area precision, resolution between critical pairs, tailing factor, and theoretical plate count. Acceptance criteria are set in the method or pharmacopeial monograph. If a suitability check fails, the run may be rejected and the instrument or sample preparation may need investigation. This practice helps prevent release of data from a system that has drifted out of control.
Another strategy for site-specific amine conjugation to proteins is to replace lysine residues with arginine residues (LDVs). If all lysines are depleted then the only remaining free amine is at the amino terminus (N-terminus) of the protein. In the case where the protein is an antibody Fc domain, a recombinant LDV Fc can still be purified using protein A. LDV Fc proteins fused with short peptide targeting sequences can be used to deliver conjugated payloads, including nanoparticles, to specific cell surface proteins. The majority of ADCs under development or in clinical trials are for oncological and hematological indications. This is primarily driven by the inventory of monoclonal antibodies, which target various types of cancer. However, some developers are looking to expand the application to other important disease areas.
At the present time the Department promotes various scientific fields, running the whole gamut of base branches of classical physical chemistry: thermodynamics, kinetics, electrochemistry, catalysis, sorption processes. As the subjects of research, organic compounds unite all the aforesaid research areas. Over the last years staff members of the Department of Physical Chemistry made reports at conferences in many countries of the world: Canada, Poland, Republic of South Africa, Italy, Germany, Portugal, Czech Republic, USA, Ireland, Croatia, Spain, Sweden, Japan, Brazil. The head of the Department is Professor Boris N. Solomonov, Doctor of Science in Chemistry. The Department conducts research in the following fields:
HA (aq) + H2O (l) ⇌ H3O+ (aq) + A− (aq) Ka Common examples of monoprotic acids in mineral acids include hydrochloric acid (HCl) and nitric acid (HNO3). On the other hand, for organic acids the term mainly indicates the presence of one carboxylic acid group and sometimes these acids are known as monocarboxylic acid. Examples in organic acids include formic acid (HCOOH), acetic acid (CH3COOH) and benzoic acid (C6H5COOH). Polyprotic acids, also known as polybasic acids, are able to donate more than one proton per acid molecule, in contrast to monoprotic acids that only donate one proton per molecule. Specific types of polyprotic acids have more specific names, such as diprotic (or dibasic) acid (two potential protons to donate), and triprotic (or tribasic) acid (three potential protons to donate). Some macromolecules such as proteins and nucleic acids can have a very large number of acidic protons. A diprotic acid (here symbolized by H2A) can undergo one or two dissociations depending on the pH. Each dissociation has its own dissociation constant, Ka1 and Ka2.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Acid–base extraction is a subclass of liquid–liquid extractions and involves the separation of chemical species from other acidic or basic compounds. It is typically performed during the work-up step following a chemical synthesis to purify crude compounds and results in the product being largely free of acidic or basic impurities. A separatory funnel is commonly used to perform an acid-base extraction. Acid-base extraction utilizes the difference in solubility of a compound in its acid or base form to induce separation. Typically, the desired compound is changed into its charged acid or base form, causing it to become soluble in aqueous solution and thus be extracted from the non-aqueous (organic) layer. Acid-base extraction is a simple alternative to more complex methods like chromatography. It is not possible to separate chemically similar acids or bases using this simple method.
Sources: en.wikipedia.org
RCO2H + R'2NH → RCO−2 + R'2NH+2 RCO−2 + R'2NH+2 → RC(O)NR'2 + H2O Esters are far superior substrates relative to carboxylic acids. Further "activating" both acid chlorides (Schotten-Baumann reaction) and anhydrides (Lumière–Barbier method) react with amines to give amides: RCO2R" + R'2NH → RC(O)NR'2 + R"OH RCOCl + 2R'2NH → RC(O)NR'2 + R'2NH+2Cl− (RCO)2O + R'2NH → RC(O)NR'2 + RCO2H Peptide synthesis use coupling agents such as HATU, HOBt, or PyBOP. The hydrolysis of nitriles is conducted on an industrial scale to produce fatty amides. Laboratory procedures are also available. Many specialized methods also yield amides. A variety of reagents, e.g. tris(2,2,2-trifluoroethyl) borate have been developed for specialized applications. Amidogen Amino radical Imidic acid Metal amides IUPAC Compendium of Chemical Terminology
After earning his doctorate in biochemistry, Lehninger held various faculty positions at the University of Wisconsin–Madison and the University of Chicago. In 1952, he went to the Johns Hopkins School of Medicine, assuming the title of DeLamar Professor of the Department of Biological Chemistry. He served in this position until 1978, when he was appointed to the role of University Professor of Medical Sciences. He held this title until his death in 1986. 1948 – Paul-Lewis Award in Enzyme Chemistry 1951 – Guggenheim Fellowship 1956 – Elected to the National Academy of Sciences 1959 – Elected to the American Academy of Arts and Sciences 1969 – Remsen Award of the American Chemical Society 1970 – American Philosophical Society 1986 – Passano Foundation Award Forthcoming in New Dictionary of Scientific Biography
Chondrocytes can be prepared by sequential enzymatic digestion of cartilage with Pronase and Collagenase and cultured in DMEM-F12 cell culture media. Transplantation of dedifferentiated chondrocytes often leads to the formation of fibrous tissue formation. Redifferentiation of dedifferentiated chondrocytes in the 3-D system (spheroid culture) restore morphological and functional properties. Carticel is a procedure for restoring articular knee cartilage with autologous chondrocyte implantation; it was the first cell therapy to be approved by the U.S. Food and Drug Administration, under accelerated approval in 1997. In Australia, Ortho-ACI, a suspension of cultured autologous chondrocytes, is indicated for use in the treatment of cartilage lesions associated with the knee, patella, and ankle. Chondronectin Endochondral ossification Intramembranous ossification List of human cell types derived from the germ layers List of distinct cell types in the adult human body Histology image: 03317loa – Histology Learning System at Boston University Stem cell information
HCl(aq) + NaOH(aq) → H2O(l) + NaCl(aq) Neutralization is the basis of titration, where a pH indicator shows equivalence point when the equivalent number of moles of a base have been added to an acid. It is often wrongly assumed that neutralization should result in a solution with pH 7.0, which is only the case with similar acid and base strengths during a reaction. Neutralization with a base weaker than the acid results in a weakly acidic salt. An example is the weakly acidic ammonium chloride, which is produced from the strong acid hydrogen chloride and the weak base ammonia. Conversely, neutralizing a weak acid with a strong base gives a weakly basic salt (e.g., sodium fluoride from hydrogen fluoride and sodium hydroxide).
Sources: en.wikipedia.org
HPLC testing separates and quantifies components in a liquid sample. It is used to check identity, purity, concentration, or stability. The technique works best for compounds that dissolve and are not easily vaporized.
The pump maintains a steady flow rate and pressure, which keeps retention times reproducible. Pulsation or flow errors can shift peaks and distort quantitation. Modern pumps use feedback control to reduce these variations.
HPLC alone usually separates compounds but does not always identify them. Retention time matching with a known standard provides tentative identification. Coupling HPLC to mass spectrometry adds mass information that supports structural identification.
HPLC separates and detects individual compounds in a liquid sample, producing peaks at characteristic retention times. Peak area or height can be used to estimate concentration when calibrated with known standards. It does not identify unknown compounds with certainty unless additional detectors or reference materials are used.